Protein basic information
LiverAtlas Protein ID |
HuLPr34816 |
Uniprot ID |
|
Uniprot Acc |
Q5C8V2; |
Protein name |
N-acetyltransferase-1 |
Comment |
SIMILARITY:Belongs to the arylamine N-acetyltransferase family. |
Gene name |
|
Protein sequence
|
DLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQV VRRNRGGWCLQVNHLLY |
Database cross reference |
RefSeq Protein accession:NP_000653
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0016407;F:acetyltransferase activity;IEA:InterPro. |