Protein basic information
LiverAtlas Protein ID |
HuLPr00010 |
Uniprot ID |
|
Uniprot Acc |
P13746;O19605;O19606;Q29747;Q29835;Q9BCN0;Q9MYI5;Q9TQE9;Q9TQP6;Q9TQP7; |
Protein name |
HLA class I histocompatibility antigen, A-11 alpha chain |
Comment |
FUNCTION:Involved in the presentation of foreign antigens to the immune system.||SUBUNIT:Heterodimer of an alpha chain and a beta chain (beta-2- microglobulin). Interacts with human herpesvirus 8 MIR1 protein (By similarity).||SUBCELLULAR LOCATION:Membrane; Single-pass type I membrane protein.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P13746-1; Sequence=Displayed; Name=2; Synonyms=Long; IsoId=P13746-2; Sequence=VSP 008099; Note=Only produced by allele A*1103;||PTM:Polyubiquitinated in a post ER compartment by interaction with human herpesvirus 8 MIR1 protein. This targets the protein for rapid degradation via the ubiquitin system (By similarity).||POLYMORPHISM:The following alleles of A-11 are known:A*11:01 (A- 11E), A*11:02 (A-11K), A*11:03, A*11:04, A*11:05 and A*11:07. The sequence shown is that of A*11:01.||SIMILARITY:Belongs to the MHC class I family.||SIMILARITY:Contains 1 Ig-like C1-type (immunoglobulin-like) domain. |
Subcellular localization |
Membrane;Single-pass type I membrane protein. |
Gene name |
|
Protein sequence
|
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPG RGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQE GPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHT IQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSW TAADMAAQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYL ENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPA EITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP SGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIA GLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDS AQGSDVSLTACKV |
Database cross reference |
RefSeq Protein accession:NP_002107
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005887;C:integral to plasma membrane;NAS:UniProtKB. GO:0042612;C:MHC class I protein complex;IEA:UniProtKB-KW. |
GO-F |
GO:0032393;F:MHC class I receptor activity;NAS:UniProtKB. |
GO-P |
GO:0002474;P:antigen processing and presentation of peptide antigen via MHC class I;IEA:UniProtKB-KW. GO:0006955;P:immune response;NAS:UniProtKB. GO:0044419;P:interspecies interaction between organisms;IEA:UniProtKB-KW. |