Protein basic information
LiverAtlas Protein ID |
HuLPr00437 |
Uniprot ID |
|
Uniprot Acc |
A1EGU3; |
Protein name |
Gamma globin |
Comment |
SIMILARITY:Belongs to the globin family. |
Gene name |
|
Protein sequence
|
LLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSR YH |
Database cross reference |
RefSeq Protein accession:NP_000175
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0020037;F:heme binding;IEA:InterPro. GO:0019825;F:oxygen binding;IEA:InterPro. GO:0005344;F:oxygen transporter activity;IEA:UniProtKB-KW. |