Protein basic information
LiverAtlas Protein ID |
HuLPr00902 |
Uniprot ID |
|
Uniprot Acc |
A4D1K0; |
Protein name |
V-type proton ATPase subunit F |
Comment |
FUNCTION:Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).||SUBUNIT:V-ATPase is an heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (By similarity).||SIMILARITY:Belongs to the V-ATPase F subunit family. |
Gene name |
|
Protein sequence
|
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVE KDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALD AHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR |
Database cross reference |
RefSeq Protein accession:NP_001185838
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0033180;C:proton-transporting V-type ATPase, V1 domain;IEA:InterPro. |
GO-F |
GO:0046933;F:hydrogen ion transporting ATP synthase activity, rotational mechanism;IEA:InterPro. GO:0046961;F:proton-transporting ATPase activity, rotational mechanism;IEA:InterPro. |
GO-P |
GO:0015991;P:ATP hydrolysis coupled proton transport;IEA:InterPro. |