Protein basic information
| LiverAtlas Protein ID |
HuLPr01421 |
|
Uniprot ID |
|
|
Uniprot Acc |
A6NFE9; |
|
Protein name |
Ubiquitin carrier protein |
|
Comment |
SIMILARITY:Belongs to the ubiquitin-conjugating enzyme family.||CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
|
Gene name |
|
|
Protein sequence
|
MFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDE PNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC |
|
Database cross reference |
RefSeq Protein accession:NP_003327
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
|
GO-F |
GO:0016881;F:acid-amino acid ligase activity;IEA:InterPro. GO:0005524;F:ATP binding;IEA:UniProtKB-KW. |
|
GO-P |
GO:0043687;P:post-translational protein modification;IEA:InterPro. |
Pathway
| Pathway name | |
| Pathway name |
