Protein basic information
LiverAtlas Protein ID |
HuLPr01876 |
Uniprot ID |
|
Uniprot Acc |
A7J1S4; |
Protein name |
Variant ATP-binding cassette sub-family B member 4 |
Gene name |
|
Protein sequence
|
NSVQKAHIYGITFSISQAFMYFSYASCFRFGAYLIVNGHM RFRDVIL |
Database cross reference |
RefSeq Protein accession:NP_000434
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:InterPro. |
GO-F |
GO:0005524;F:ATP binding;IEA:UniProtKB-KW. GO:0042626;F:ATPase activity, coupled to transmembrane movement of substances;IEA:InterPro. |