Protein basic information
| LiverAtlas Protein ID |
HuLPr01887 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q96GX2; |
|
Protein name |
Putative ataxin-7-like protein 3B |
|
Comment |
MISCELLANEOUS:Encoded by an expressed retrotransposed copy of the ATXN7L3 locus that emerged prior to the speciation event separating primates and rodents.||SIMILARITY:Belongs to the SGF11 family.||SEQUENCE CAUTION:Sequence=AAH09111.1; Type=Erroneous translation; Note=Wrong choice of CDS; |
|
Gene name |
|
|
Protein sequence
|
MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRA VKCGYFYLEFAETGSVKDFGIQPVEDKGACRLPLCSLPG EPGNGPDQQLQRSPPEFQ |
|
Database cross reference |
RefSeq Protein accession:NP_001129734
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr01887 |
PHOSPHORYLATION |
92 |
S |
PhosphoSitePlus |
LTP |
N |
 
|
