Protein basic information
LiverAtlas Protein ID |
HuLPr02059 |
Uniprot ID |
|
Uniprot Acc |
A8K014; |
Protein name |
cDNA FLJ76503, highly similar to Homo sapiens cAMP responsive element modulator (CREM), transcript variant 8, mRNA |
Comment |
SIMILARITY:Belongs to the bZIP family. |
Gene name |
|
Protein sequence
|
MNRTQELSGQLSAATGDMPTYQIRAPTAALPQGVVMAASP GSLHSPQQLAEEATRKRELRLMKNREAARECRRKKKEYV KCLENRVAVLENQNKTLIEELKALKDLYCHKVE |
Database cross reference |
RefSeq Protein accession:NP_001872
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;IEA:UniProtKB-KW. |
GO-F |
GO:0046983;F:protein dimerization activity;IEA:InterPro. GO:0043565;F:sequence-specific DNA binding;IEA:InterPro. GO:0003700;F:sequence-specific DNA binding transcription factor activity;IEA:InterPro. |
GO-P |
GO:0006355;P:regulation of transcription, DNA-dependent;IEA:InterPro. |
Pathway
Pathway name | |
Pathway name | |
Pathway name | |
Pathway name | |
Pathway name |