Protein basic information
LiverAtlas Protein ID |
HuLPr02115 |
Uniprot ID |
|
Uniprot Acc |
A8K0N0; |
Protein name |
Signal recognition particle 9 kDa protein |
Comment |
FUNCTION:Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding (By similarity).||SUBCELLULAR LOCATION:Cytoplasm (By similarity).||SIMILARITY:Belongs to the SRP9 family. |
Subcellular localization |
Cytoplasm(By similarity). |
Gene name |
|
Protein sequence
|
MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCV KVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEAR NVTMETE |
Database cross reference |
RefSeq Protein accession:NP_003124
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005786;C:signal recognition particle, endoplasmic reticulum targeting;IEA:UniProtKB-KW. |
GO-F |
GO:0008312;F:7S RNA binding;IEA:InterPro. |
GO-P |
GO:0045900;P:negative regulation of translational elongation;IEA:InterPro. GO:0006614;P:SRP-dependent cotranslational protein targeting to membrane;IEA:InterPro. |