Protein basic information
LiverAtlas Protein ID |
HuLPr02851 |
Uniprot ID |
|
Uniprot Acc |
A8K777; |
Protein name |
Caveolin |
Comment |
FUNCTION:May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity).||SUBCELLULAR LOCATION:Golgi apparatus membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein (By similarity).||SIMILARITY:Belongs to the caveolin family. |
Subcellular localization |
Golgi apparatus membrane;Peripheral membrane protein.Cell membrane;Peripheral membrane protein.Membrane, caveola;Peripheral membrane protein(By similarity). |
Gene name |
|
Protein sequence
|
MAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDF EDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLL GVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISH IYSLCIRTFCNPLFAALGQVCSSIKVVLRKEV |
Database cross reference |
RefSeq Protein accession:NP_001225
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005901;C:caveola;IEA:UniProtKB-SubCell. GO:0000139;C:Golgi membrane;IEA:UniProtKB-SubCell. |
Pathway
Pathway name |