Protein basic information
LiverAtlas Protein ID |
HuLPr03305 |
Uniprot ID |
|
Uniprot Acc |
A8MTP8; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific) |
Protein sequence
|
MNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLC NYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCN SREEISSPPNSV |
Database cross reference |
RefSeq Protein accession:NP_001026836
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:InterPro. |