Protein basic information
LiverAtlas Protein ID |
HuLPr03489 |
Uniprot ID |
|
Uniprot Acc |
A8YQE4; |
Protein name |
Interferon gamma |
Comment |
FUNCTION:Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons (By similarity).||SUBUNIT:Homodimer (By similarity).||SUBCELLULAR LOCATION:Secreted (By similarity).||SIMILARITY:Belongs to the type II (or gamma) interferon family. |
Subcellular localization |
Secreted(By similarity). |
Gene name |
|
Protein sequence
|
MKYTSYILAFQXCIVLGSLGCYCQDPYVKEAENLKKYFNA GHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKL FKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKL TNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQM LFRGRRASQ |
Database cross reference |
RefSeq Protein accession:NP_000610
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005615;C:extracellular space;IEA:UniProtKB-KW. |
GO-F |
GO:0005125;F:cytokine activity;IEA:UniProtKB-KW. GO:0005133;F:interferon-gamma receptor binding;IEA:InterPro. |
GO-P |
GO:0006955;P:immune response;IEA:InterPro. GO:0040008;P:regulation of growth;IEA:UniProtKB-KW. GO:0009615;P:response to virus;IEA:UniProtKB-KW. |