Protein basic information
LiverAtlas Protein ID |
HuLPr03598 |
Uniprot ID |
|
Uniprot Acc |
Q8IUX4;B0QYD4;Q45F03;Q7Z2N2;Q7Z2N5; |
Protein name |
DNA dC->dU-editing enzyme APOBEC-3F |
Comment |
FUNCTION:After being packaged into HIV-1 virions, blocks productive infection by massively editing dC residues to dU on the DNA minus strand during reverse transcription. The editing of the minus strand DNA of HIV-1 during reverse transcription leads to G- to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations.||COFACTOR:Zinc (By similarity).||SUBUNIT:Forms heterodimers with APOBEC3G. Binds HIV-1 Vif. In the absence of Vif protein, specifically packaged into HIV-1 virions.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8IUX4-1; Sequence=Displayed; Name=2; IsoId=Q8IUX4-2; Sequence=VSP 009803, VSP 009804; Note=May be due to a competing donor splice site. No experimental confirmation available;||TISSUE SPECIFICITY:Widely expressed, including in lymphoid tissues, such as thymus and peripheral blood leukocytes. No |
Gene name |
apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F |
Protein sequence
|
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVK TKGPSRPRLDAKIFRGQVYSQPEHHAEMCFLSWFCGNQL PAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTIS AARLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWE NFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMY PHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKR GVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWY TSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTD YQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFK PWKGLKYNFLFLDSKLQEILE |
Database cross reference |
RefSeq Protein accession:NP_001006667
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0030895;C:apolipoprotein B mRNA editing enzyme complex;TAS:HGNC. |
GO-F |
GO:0004126;F:cytidine deaminase activity;IDA:HGNC. GO:0003723;F:RNA binding;IDA:HGNC. GO:0008270;F:zinc ion binding;IDA:HGNC. |
GO-P |
GO:0016553;P:base conversion or substitution editing;IDA:HGNC. GO:0045087;P:innate immune response;IDA:HGNC. GO:0045869;P:negative regulation of retroviral genome replication;IDA:HGNC. GO:0002230;P:positive regulation of defense response to virus by hos |