Protein basic information
LiverAtlas Protein ID |
HuLPr03651 |
Uniprot ID |
|
Uniprot Acc |
Q96IU4;Q86VK8;Q8N8W5; |
Protein name |
Abhydrolase domain-containing protein 14B |
Comment |
FUNCTION:Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.||SUBUNIT:May interact with TAF1.||SUBCELLULAR LOCATION:Cytoplasm. Nucleus. Note=Predominantly cytoplasmic.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96IU4-1; Sequence=Displayed; Name=2; IsoId=Q96IU4-2; Sequence=VSP 008058; Note=No experimental confirmation available;||TISSUE SPECIFICITY:Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney.||SIMILARITY:Belongs to the AB hydrolase superfamily. ABHD14 family.||SEQUENCE CAUTION:Sequence=AAH50650.1; Type=Erroneous initiation; |
Subcellular localization |
Cytoplasm.Nucleus. |
Gene name |
|
Protein sequence
|
MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHG IRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAA APAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSL PFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIV YGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPE EWHTGLLDFLQGLQ |
Database cross reference |
RefSeq Protein accession:NP_001139786
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;IEA:UniProtKB-SubCell. GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
GO-F |
GO:0016787;F:hydrolase activity;IEA:UniProtKB-KW. |