Protein basic information
LiverAtlas Protein ID |
HuLPr04020 |
Uniprot ID |
|
Uniprot Acc |
P20292;Q5VV04; |
Protein name |
Arachidonate 5-lipoxygenase-activating protein |
Comment |
FUNCTION:Required for leukotriene biosynthesis by ALOX5 (5- lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.||SUBUNIT:Homotrimer. Interacts with LTC4S and ALOX5.||SUBCELLULAR LOCATION:Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.||DOMAIN:The C-terminal part after residue 140 is mostly unstructured.||DISEASE:Genetic variations in ALOX5AP may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneo |
Subcellular localization |
Nucleus membrane;Multi-pass membrane protein.Endoplasmic reticulum membrane;Multi-pass membrane protein. |
Gene name |
|
Protein sequence
|
MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGR SFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCS QVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRI ILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPL LLIP |
Database cross reference |
RefSeq Protein accession:NP_001191335
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005789;C:endoplasmic reticulum membrane;IEA:UniProtKB-SubCell. GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005792;C:microsome;ISS:RefGenome. GO:0031965;C:nuclear membrane;IDA:UniProtKB. |
GO-F |
GO:0050544;F:arachidonic acid binding;IDA:UniProtKB. GO:0047485;F:protein N-terminus binding;IPI:UniProtKB. |
GO-P |
GO:0071277;P:cellular response to calcium ion;IDA:UniProtKB. GO:0019370;P:leukotriene biosynthetic process;IDA:UniProtKB. GO:0002540;P:leukotriene production involved in inflammatory response;ISS:RefGenome. GO:0070207;P:protein homotrimerization;IPI:Uni |
Pathway
Pathway name | |
Pathway name | |
Pathway name |