Protein basic information
| LiverAtlas Protein ID |
HuLPr04310 |
|
Uniprot ID |
|
|
Uniprot Acc |
P02647;A8K866;Q6LDN9;Q6Q785;Q9UCS8;Q9UCT8; |
|
Protein name |
Apolipoprotein A-I |
|
Comment |
FUNCTION:Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.||SUBUNIT:Interacts with APOA1BP and CLU. Component of a sperm activating protein complex (SPAP), consisting of APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain and albumin.||INTERACTION:P05067:APP; NbExp=5; IntAct=EBI-701692, EBI-77613;||SUBCELLULAR LOCATION:Secreted.||TISSUE SPECIFICITY:Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine.||PTM:Palmitoylated.||PTM:Phosphorylation sites are present in the extracelllular medium.||DISEASE:Defects in APOA1 are a cause of high density lipoprotein deficiency type 2 (HDLD2) [MIM:604091]; also known as familial hypoalphalipoproteinemia (FHA). Inheritance is autosomal dominant.||DISEASE:Defect |
|
Subcellular localization |
Secreted. |
|
Gene name |
|
|
Related liver disease name |
|
|
Protein sequence
|
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLAT VYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTS TFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVK AKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQK LHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQ RLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPAL EDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ |
|
Database cross reference |
RefSeq Protein accession:NP_000030
|
Liver relevance
| Liver sepcificity |
Yes/No |
Yes |
|
Evidence |
Translational level from literatures |
|
|
Quality score |
|
|
|
HCC significant Proteins |
Yes/No |
Yes |
|
Quality score |
|
|
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0030139;C:endocytic vesicle;IDA:BHF-UCL. GO:0005788;C:endoplasmic reticulum lumen;EXP:Reactome. GO:0005886;C:plasma membrane;EXP:Reactome. GO:0034366;C:spherical high-density lipoprotein particle;IDA:BHF-UCL. GO:0030141;C:stored secretory granule;EX |
|
GO-F |
GO:0034191;F:apolipoprotein A-I receptor binding;IPI:BHF-UCL. GO:0001540;F:beta-amyloid binding;IDA:BHF-UCL. GO:0015485;F:cholesterol binding;IDA:BHF-UCL. GO:0017127;F:chole |