Protein basic information
| LiverAtlas Protein ID |
HuLPr04318 |
|
Uniprot ID |
|
|
Uniprot Acc |
P02656;Q08E83;Q6Q786; |
|
Protein name |
Apolipoprotein C-III |
|
Comment |
FUNCTION:Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles.||SUBCELLULAR LOCATION:Secreted.||TISSUE SPECIFICITY:Constitutes 50% of the protein fraction of VLDL and 2% of that of HDL. Synthesized predominantly in liver and to a lesser degree in intestine.||PTM:O-linked glycan consists of Gal-GalNAc disaccharide, further modified with up to 3 sialic acid residues. O-glycosylated on Thr- 94 with a core 1 or possibly core 8 glycan.||DISEASE:Defects in APOC3 may be a cause of hyperalphalipoproteinemia (HYPALIP) [MIM:143470]. Affected individuals show high levels of alpha-lipoprotein (high density lipoprotein/HDL).||SIMILARITY:Belongs to the apolipoprotein C3 family.||WEB RESOURCE:Name=GeneReviews; URL="http://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/APOC3"; |
|
Subcellular localization |
Secreted. |
|
Gene name |
|
|
Related liver disease name |
|
|
Protein sequence
|
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHAT KTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKD KFSEFWDLDPEVRPTSAVAA |
|
Database cross reference |
RefSeq Protein accession:NP_000031
|
Liver relevance
| Liver sepcificity |
Yes/No |
Yes |
|
Evidence |
BodyMap |
|
|
Quality score |
|
|
|
HCC significant Proteins |
Yes/No |
Yes |
|
Quality score |
|
|
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0042627;C:chylomicron;IDA:BHF-UCL. GO:0034363;C:intermediate-density lipoprotein particle;IDA:BHF-UCL. GO:0034366;C:spherical high-density lipoprotein particle;IDA:BHF-UCL. GO:0034361;C:very-low-density lipoprotein particle;IDA:BHF-UCL. |
|
GO-F |
GO:0015485;F:cholesterol binding;IC:BHF-UCL. GO:0070653;F:high-density lipoprotein particle receptor binding;IPI:BHF-UCL. GO:0055102;F:lipase inhibitor activity;IDA:BHF-UCL. GO:0005543;F:phospholipid binding;IDA:BHF-UCL. |
|
GO-P |
GO:0032488;P:Cdc42 protein signal transduction;IDA:BHF-UCL. GO:00 |