Protein basic information
| LiverAtlas Protein ID |
HuLPr04354 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q9Y2Y0;B3KQJ5;Q504R0; |
|
Protein name |
ADP-ribosylation factor-like protein 2-binding protein |
|
Comment |
FUNCTION:Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.||SUBUNIT:Found in a complex with ARL2BP, ARL2 and SLC25A6. Found in a complex with ARL2, ARL2BP and SLC25A4. Interacts with STAT2, STAT3 and STAT4. Interacts with ARL2 (By similarity). Interacts with GTP bound ARL2 and ARL3; the complex ARL2-ARL2BP as well as ARL2BP alone, binds to ANT1. Interacts with STAT3; interaction is enhanced with ARL2.||SUBCELLULAR LOCATION:Cytoplasm. Mitochondrion intermembrane space. Cytoplasm, cytoskeleton, centrosome. Nucleus. Cytoplasm, cytoskeleton, spindle. Note=The complex formed with ARL2BP, ARL2 and SLC25A4 is expressed in mitochondria (By similarity). Detected in the midbody matrix. Not detected in the Golgi, nucleus and on the mitotic spindle. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isof |
|
Subcellular localization |
Cytoplasm.Mitochondrion intermembrane space.Cytoplasm, cytoskeleton, centrosome.Nucleus.Cytoplasm, cytoskeleton, spindle. |
|
Gene name |
|
|
Protein sequence
|
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLL QRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEE QLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDF LAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPAS QNNLRH |
|
Database cross reference |
RefSeq Protein accession:NP_036238
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0005813;C:centrosome;IDA:UniProtKB. GO:0030496;C:midbody;IDA:UniProtKB. GO:0005758;C:mitochondrial intermembrane space;IDA:UniProtKB. GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. GO:0005819;C:spindle;IEA:UniProtKB-SubCell. |
|
GO-F |
GO:0005515;F:protein binding;IPI:UniProtKB. GO:0005083;F:small GTPase regulator activity;TAS:ProtInc. GO:0003713;F:transcription coactivator activity;IMP:UniProtKB. |
|
GO-P |
GO:0051457;P:maintenance of protein location in nucleus;IMP:UniProtKB. GO:0042517;P:positive regulation of tyrosine phosphorylation of Stat3 protein;IMP:UniProtKB. GO:0007165;P:signal transduction;TAS:ProtInc. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr04354 |
PHOSPHORYLATION |
157 |
S |
Phospho-ELM |
HTP |
N |
 
|
|
|
HuLPr04354 |
PHOSPHORYLATION |
157 |
S |
PhosphoSitePlus |
LTP |
N |
|
