Protein basic information
LiverAtlas Protein ID |
HuLPr04735 |
Uniprot ID |
|
Uniprot Acc |
Q58HT5;Q5JT21;Q6IEE4; |
Protein name |
Acyl-CoA wax alcohol acyltransferase 1 |
Comment |
FUNCTION:Acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. Has a preference for arachidyl alcohol as well as decyl alcohol, demonstrating its relatively poor activity using saturated long chain alcohols (C16, C18, and C20).||CATALYTIC ACTIVITY:Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.||BIOPHYSICOCHEMICAL PROPERTIES:Kinetic parameters: Vmax=31.7 pmol/min/mg enzyme with [14C]oleoyl-CoA as substrate; Vmax=113 pmol/min/mg enzyme with [14C]cetyl-CoA as substrate;||SUBCELLULAR LOCATION:Endoplasmic reticulum membrane; Multi-pass membrane protein (By similarity).||TISSUE SPECIFICITY:Predominantly expressed in skin, where it is limited to the sebaceous gland. Expressed in more mature, centrally located cells just before their rupture and sebum release. Also expressed in all tissues except spleen. |
Subcellular localization |
Endoplasmic reticulum membrane;Multi-pass membrane protein(By similarity). |
Gene name |
|
Protein sequence
|
MAHSKQPSHFQSLMLLQWPLSYLAIFWILQPLFVYLLFTS LWPLPVLYFAWLFLDWKTPERGGRRSAWVRNWCVWTHIR DYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCT EATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVCS VSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTLI LQKRKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHKDS RMYKFQSCFRRIFGFYCCVFYGQSFCQGSTGLLPYSRPI VTVVGEPLPLPQIEKPSQEMVDKYHALYMDALHKLFDQH KTHYGCSETQKLFFL |
Database cross reference |
RefSeq Protein accession:NP_001013597
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005789;C:endoplasmic reticulum membrane;IEA:UniProtKB-SubCell. GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |
GO-F |
GO:0047196;F:long-chain-alcohol O-fatty-acyltransferase activity;IEA:EC. |
GO-P |
GO:0008610;P:lipid biosynthetic process;IEA:UniProtKB-KW. |
Pathway
Pathway name |