Protein basic information
LiverAtlas Protein ID |
HuLPr05071 |
Uniprot ID |
|
Uniprot Acc |
B1ALC0; |
Protein name |
Actin-related protein 2/3 complex subunit 5 |
Comment |
FUNCTION:Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks (By similarity).||SIMILARITY:Belongs to the ARPC5 family. |
Gene name |
|
Protein sequence
|
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEG EVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIV LKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPS DNSSAMLLQWHEKVPLV |
Database cross reference |
RefSeq Protein accession:NP_005708
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver; |
Ontology annotation
GO-C |
GO:0005856;C:cytoskeleton;IEA:UniProtKB-KW. |
GO-P |
GO:0030833;P:regulation of actin filament polymerization;IEA:InterPro. |