Protein basic information
LiverAtlas Protein ID |
HuLPr11035 |
Uniprot ID |
|
Uniprot Acc |
B5MCC7; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENW RVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQVP SLDLKLCVLCFSGSLTAVLFLTGTWAGPQTQEL |
Database cross reference |
RefSeq Protein accession:NP_001035739
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-F |
GO:0004725;F:protein tyrosine phosphatase activity;IEA:InterPro. |