Protein basic information
| LiverAtlas Protein ID |
HuLPr12932 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q9NYM9;B3KMY0; |
|
Protein name |
BET1-like protein |
|
Comment |
FUNCTION:Vesicle SNARE required for targeting and fusion of retrograde transport vesicles with the Golgi complex. Required for the integrity of the Golgi complex (By similarity).||SUBUNIT:Component of a SNARE complex consisting of STX5, YKT6, GOSR2 and BET1L (By similarity).||SUBCELLULAR LOCATION:Golgi apparatus membrane; Single-pass type IV membrane protein (By similarity).||SIMILARITY:Contains 1 t-SNARE coiled-coil homology domain. |
|
Subcellular localization |
Golgi apparatus membrane;Single-pass type IV membrane protein(By similarity). |
|
Gene name |
|
|
Protein sequence
|
MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLAL DIDRDAEDQNRYLDGMDSDFTSMTSLLTGSVKRFSTMAR SGQDNRKLLCGMAVGLIVAFFILSYFLSRART |
|
Database cross reference |
RefSeq Protein accession:NP_001092257
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
| GO-C |
GO:0005768;C:endosome;IDA:HGNC. GO:0031201;C:SNARE complex;TAS:HGNC. |
|
GO-F |
GO:0005484;F:SNAP receptor activity;IDA:HGNC. |
|
GO-P |
GO:0015031;P:protein transport;IEA:UniProtKB-KW. GO:0042147;P:retrograde transport, endosome to Golgi;IDA:HGNC. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr12932 |
PHOSPHORYLATION |
9 |
S |
Phospho-ELM |
HTP |
N |
 
|
|
|
HuLPr12932 |
PHOSPHORYLATION |
9 |
S |
PhosphoSitePlus |
LTP |
N |
|
