Protein basic information
LiverAtlas Protein ID |
HuLPr12933 |
Uniprot ID |
|
Uniprot Acc |
Q9HBH7;A0AVN1;A8K4J3;Q9NZ33; |
Protein name |
Protein BEX1 |
Comment |
FUNCTION:Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (By similarity).||SUBUNIT:Interacts with neurotrophin receptor p75NTR/NGFR. Interacts with OMP (By similarity).||SUBCELLULAR LOCATION:Nucleus. Cytoplasm. Note=Shuttles between the cytoplasm and the nucleus (By similarity).||TISSUE SPECIFICITY:Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Expressed in lung, skeletal muscle, peripheral blood leukocyte, stomach, lymph node, trachea and bone marrow. Highly expressed in acute myeloid leukemia.||PTM:Phosphorylated. Phosphorylation of Ser-102 protects i |
Subcellular localization |
Nucleus.Cytoplasm. |
Gene name |
|
Protein sequence
|
MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDA GEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMRE ENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHH DEFCLMP |
Database cross reference |
RefSeq Protein accession:NP_060946
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;IEA:UniProtKB-SubCell. GO:0005634;C:nucleus;IEA:UniProtKB-SubCell. |
GO-P |
GO:0030154;P:cell differentiation;IEA:UniProtKB-KW. GO:0007399;P:nervous system development;IEA:UniProtKB-KW. |
Pathway
Pathway name |