Protein basic information
LiverAtlas Protein ID |
HuLPr13188 |
Uniprot ID |
|
Uniprot Acc |
Q13901;A8K336;D6W5F8;Q05D64; |
Protein name |
Nuclear nucleic acid-binding protein C1D |
Comment |
FUNCTION:Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB (By similarity).||SUBUNIT:Monomer and homodimer. Interacts with NR1D1, THRA, THRB, NCOR1 and NCOR2 (By similarity). Interacts with EXOSC10; the interaction probably mediates the association with the nuclear form of the RNA exosome. The homodimeric form interacts with TSNAX following gamma-radiation. Interacts with RAC3.||SUBCELLULAR LOCATION:Cytoplasm. Nucleus, nucleolus. Note=EXOSC10 is required for nucleolar localization.||TISSUE SPECIFICITY:Ubiquitous. Expressed at very high levels in the hippocampus, medulla oblongata, mammary gland, thyroid and salivary gland. |
Subcellular localization |
Cytoplasm.Nucleus, nucleolus. |
Gene name |
|
Protein sequence
|
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSR NELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPK EHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFV KNALWEPKSKNASKVANKGKSKS |
Database cross reference |
RefSeq Protein accession:NP_001177192
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;IEA:UniProtKB-SubCell. GO:0000176;C:nuclear exosome (RNase complex);TAS:UniProtKB. GO:0005730;C:nucleolus;IEA:UniProtKB-SubCell. |
GO-F |
GO:0003677;F:DNA binding;TAS:ProtInc. GO:0003723;F:RNA binding;IDA:UniProtKB. |
GO-P |
GO:0006915;P:apoptosis;IEA:UniProtKB-KW. GO:0000460;P:maturation of 5.8S rRNA;IMP:UniProtKB. GO:0006355;P:regulation of transcription, DNA-dependent;IEA:UniProtKB-KW. GO:0006351;P:transcription, DNA-dependent;IEA:UniProtKB-KW. |