Protein basic information
LiverAtlas Protein ID |
HuLPr13189 |
Uniprot ID |
|
Uniprot Acc |
Q96EU7;A8K246;Q8WWS3;Q9NZX1; |
Protein name |
C1GALT1-specific chaperone 1 |
Comment |
FUNCTION:Probable chaperone required for the generation of 1 O- glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Probably acts as a specific molecular chaperone assisting the folding/stability of core 1 beta-3-galactosyltransferase (C1GALT1).||SUBUNIT:Associates with core 1 beta-3-galactosyltransferase (C1GALT1), probably not with the soluble active form.||SUBCELLULAR LOCATION:Membrane; Single-pass type II membrane protein (Potential).||TISSUE SPECIFICITY:Ubiquitously expressed. Abundantly expressed in salivary gland, stomach, small intestine, kidney, and testis and at intermediate levels in whole brain, cerebellum, spinal cord, thymus, spleen, trachea, lung, pancreas, ovary, and uterus.||DISEASE:Defects in C1GALT1C1 are the cause of Tn syndrome (TNSYN) [MIM:300622]. Tn syndrome is a rare autoimmune disease caused by somatic mutation in the C1GALT1C1 gene in which subpopulations of blood cells of all lineages carry |
Subcellular localization |
Membrane;Single-pass type II membrane protein(Potential). |
Gene name |
|
Protein sequence
|
MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHE HHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKD VSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDM WLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYF LLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKR LNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAE NAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDM AVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND |
Database cross reference |
RefSeq Protein accession:NP_001011551
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |