Protein basic information
LiverAtlas Protein ID |
HuLPr13732 |
Uniprot ID |
|
Uniprot Acc |
C9J0J7; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIR TKSQGGEPTYNVAVGRAGRALVIVMGKEGVHGGTLNKKA YELALYLRRSDV |
Database cross reference |
RefSeq Protein accession:NP_002619
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0015629;C:actin cytoskeleton;IEA:InterPro. |
GO-F |
GO:0003779;F:actin binding;IEA:InterPro. |
GO-P |
GO:0030036;P:actin cytoskeleton organization;IEA:InterPro. |