Protein basic information
LiverAtlas Protein ID |
HuLPr13918 |
Uniprot ID |
|
Uniprot Acc |
C9JD66; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
translocase of outer mitochondrial membrane 5 homolog (yeast) |
Protein sequence
|
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRV SECLPGCDCETSGELTDGHPLTLRGHRGLRTELNGSGEQ GGCALKATGICAV |
Database cross reference |
RefSeq Protein accession:NP_001001790
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |