Protein basic information
LiverAtlas Protein ID |
HuLPr14012 |
Uniprot ID |
|
Uniprot Acc |
C9JJ59; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MRFMMMRAENFFILRRKPVEGYDISFLITNFHTEQMYKHK LVDFVIHFMEEIDKEISEMKLSVNARARIVAEEFLKNF |
Database cross reference |
RefSeq Protein accession:NP_001020130
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005856;C:cytoskeleton;IEA:InterPro. |
GO-P |
GO:0030041;P:actin filament polymerization;IEA:InterPro. |
Pathway
Pathway name |