Protein basic information
LiverAtlas Protein ID |
HuLPr14084 |
Uniprot ID |
|
Uniprot Acc |
C9JNH3; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MLLTIEDTQSHYVAQAGLELLASSDPPTLASQ |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |