Protein basic information
LiverAtlas Protein ID |
HuLPr14090 |
Uniprot ID |
|
Uniprot Acc |
C9JNS5; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENW RVDSAATSGGSLTAVLFLTGTWAGPQTKSCAA |
Database cross reference |
RefSeq Protein accession:NP_001035739
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005737;C:cytoplasm;IEA:InterPro. |
GO-F |
GO:0003993;F:acid phosphatase activity;IEA:InterPro. GO:0004726;F:non-membrane spanning protein tyrosine phosphatase activity;IEA:InterPro. |