Protein basic information
LiverAtlas Protein ID |
HuLPr14221 |
Uniprot ID |
|
Uniprot Acc |
C9JXH3; |
Protein name |
Uncharacterized protein |
Comment |
SIMILARITY:Belongs to the peptidase S1 family.||CAUTION:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQV LVASRGRAVCGGVLVHPQWVLTAAHCIRK |
Database cross reference |
RefSeq Protein accession:NP_001025218
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-F |
GO:0004252;F:serine-type endopeptidase activity;IEA:InterPro. |
GO-P |
GO:0006508;P:proteolysis;IEA:InterPro. |
Pathway
Pathway name |