Protein basic information
LiverAtlas Protein ID |
HuLPr14390 |
Uniprot ID |
|
Uniprot Acc |
Q96MR7;Q5T438;Q8N372; |
Protein name |
Putative uncharacterized protein C1orf145 |
Comment |
ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96MR7-1; Sequence=Displayed; Note=May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay; Name=2; IsoId=Q96MR7-2; Sequence=VSP 024211, VSP 024212; Note=No experimental confirmation available;||CAUTION:Product of a dubious gene prediction.||SEQUENCE CAUTION:Sequence=CAI15073.1; Type=Erroneous initiation; Note=Translation N-terminally extended; |
Gene name |
|
Protein sequence
|
MYTASSSAETLRTVRRRSVPSSSMPYLALAHNRVSSLNHA ASVDGWGTSHRNVADSFSRTSRSCSRFLKGTAGSARRED WNGHLQPWIPRPDRRGWETADRKGERTQVHGLRRSLGPR APHPGAHRALRPAQSCRSGPRGWTPCRCRGRGPTACRRGS |
Database cross reference |
RefSeq Protein accession:NP_001020666
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver; |