Protein basic information
LiverAtlas Protein ID |
HuLPr14732 |
Uniprot ID |
|
Uniprot Acc |
Q8WVI0; |
Protein name |
UPF0640 protein C3orf78 |
Comment |
SUBCELLULAR LOCATION:Membrane; Single-pass membrane protein (Potential).||SIMILARITY:Belongs to the UPF0640 family.||SEQUENCE CAUTION:Sequence=AAH17996.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; |
Subcellular localization |
Membrane;Single-pass membrane protein(Potential). |
Gene name |
|
Protein sequence
|
MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIM IKVRVGQETFYDVYRRKASERQYQRRLEDE |
Database cross reference |
RefSeq Protein accession:NP_001118239
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |