Protein basic information
LiverAtlas Protein ID |
HuLPr14939 |
Uniprot ID |
|
Uniprot Acc |
O00421;B4DKQ8;O75307;Q4VBB0;Q6IPX0;Q96KP5;Q9UPG0; |
Protein name |
C-C chemokine receptor-like 2 |
Comment |
FUNCTION:Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses.||SUBCELLULAR LOCATION:Cell membrane; Multi-pass membrane protein.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=CRAM-B; IsoId=O00421-1; Sequence=Displayed; Name=2; Synonyms=CRAM-A; IsoId=O00421-2; Sequence=VSP 018584;||TISSUE SPECIFICITY:Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T- cells (both CD4+ and CD8+), monocyte-derived iDCs, NK cells, and CD34+ progenitor cells. B cells expressed isoform 1 but not isoform 2. Up-regulated on sy |
Subcellular localization |
Cell membrane;Multi-pass membrane protein. |
Gene name |
|
Protein sequence
|
MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQL VPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLN LAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSET FFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWV TAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFW KHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYS LFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKS SYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCR CFHLRSNTPLQPRGQSAQGTSREEPDHSTEV |
Database cross reference |
RefSeq Protein accession:NP_001124382
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005887;C:integral to plasma membrane;IDA:UniProtKB. |
GO-F |
GO:0048020;F:CCR chemokine receptor binding;IPI:UniProtKB. GO:0004950;F:chemokine receptor activity;TAS:ProtInc. |
GO-P |
GO:0006935;P:chemotaxis;TAS:ProtInc. GO:0006954;P:inflammatory response;ISS:UniProtKB. |
Pathway
Pathway name |