Protein basic information
LiverAtlas Protein ID |
HuLPr15006 |
Uniprot ID |
|
Uniprot Acc |
Q8IX05;Q15009; |
Protein name |
CD302 antigen |
Comment |
SUBCELLULAR LOCATION:Membrane; Single-pass type I membrane protein (Potential).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8IX05-1; Sequence=Displayed; Note=Produced by intergenic splicing of LY75 and CD302; Name=2; Synonyms=Fusion protein variant V34-2; IsoId=O60449-2; Sequence=External; Note=Produced by intergenic splicing of LY75 and CD302; Name=3; Synonyms=Fusion protein variant V33-2; IsoId=O60449-3; Sequence=External; Note=Produced by intergenic splicing of LY75 and CD302;||TISSUE SPECIFICITY:Expressed in myeloid and B lymphoid cell lines. Isoform 2 and isoform 3 are expressed in malignant Hodgkin lymphoma cells called Hodgkin and Reed-Sternberg (HRS) cells.||MISCELLANEOUS:Isoform 2 and isoform 3 are produced in HRS cells by a transcriptional control mechanism which cotranscribe an mRNA containing LY75 and CD302 prior to generating the intergenically spliced mRNA to produce LY75/CD302 fusion proteins.||SIMILARITY:Contains 1 C-ty |
Subcellular localization |
Membrane;Single-pass type I membrane protein(Potential). |
Gene name |
|
Protein sequence
|
MLRAALPALLLPLLGLAAAAVADCPSSTWIQFQDSCYIFL QEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTL KKQWKGPDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQ DDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAI PYKRKYLSDNHILISALVIASTVILTVLGAIIWFLYKKH SDSRFTTVFSTAPQSPYNEDCVLVVGEENEYPVQFD |
Database cross reference |
RefSeq Protein accession:NP_001185692
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |
GO-F |
GO:0005529;F:sugar binding;IEA:UniProtKB-KW. |
Pathway
Pathway name |