Protein basic information
LiverAtlas Protein ID |
HuLPr15035 |
Uniprot ID |
|
Uniprot Acc |
P32970;Q96J57; |
Protein name |
CD70 antigen |
Comment |
FUNCTION:Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.||SUBUNIT:Homotrimer (Probable).||SUBCELLULAR LOCATION:Membrane; Single-pass type II membrane protein.||SIMILARITY:Belongs to the tumor necrosis factor family. |
Subcellular localization |
Membrane;Single-pass type II membrane protein. |
Gene name |
|
Protein sequence
|
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQR FAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGP ALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSST TASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQR LTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
Database cross reference |
RefSeq Protein accession:NP_001243
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0005615;C:extracellular space;IEA:UniProtKB-KW. GO:0000299;C:integral to membrane of membrane fraction;IDA:HGNC. GO:0005887;C:integral to plasma membrane;TAS:ProtInc. |
GO-F |
GO:0005125;F:cytokine activity;IEA:UniProtKB-KW. GO:0002020;F:protease binding;IPI:BHF-UCL. GO:0005164;F:tumor necrosis factor receptor binding;IEA:InterPro. |
GO-P |
GO:0008283;P:cell proliferation;TAS:ProtInc. GO:0007267;P:cell-cell signaling;TAS:ProtInc. GO:0006955;P:immune response;IEA:InterPro. GO:0006917;P:induction of apoptosis;IDA:HGNC. GO:0007165;P:signal transduction;TAS:ProtInc. |
Pathway
Pathway name | |
Pathway name | |
Pathway name |