Protein basic information
LiverAtlas Protein ID |
HuLPr15144 |
Uniprot ID |
|
Uniprot Acc |
Q7Z3B0;B9EJC4; |
Protein name |
UPF0542 protein C5orf43 |
Comment |
SUBCELLULAR LOCATION:Membrane; Single-pass membrane protein (Potential).||SIMILARITY:Belongs to the UPF0542 protein family. |
Subcellular localization |
Membrane;Single-pass membrane protein(Potential). |
Gene name |
|
Protein sequence
|
MFDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVL SWKLAKMIEAREKEQKKKQKRQENIAKAKRLKKD |
Database cross reference |
RefSeq Protein accession:NP_001041714
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |