Protein basic information
LiverAtlas Protein ID |
HuLPr15230 |
Uniprot ID |
|
Uniprot Acc |
A8MT69;O00281;O00282;Q96DD4;Q96F51; |
Protein name |
Centromere protein X |
Comment |
FUNCTION:DNA-binding component of the FA core complex involved in DNA damage repair and genome maintenance. Recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions. As a component of the APITD1/CENPS complex, is also essential for the stable assembly of the outer kinetchore.||SUBUNIT:Component of a discrete APITD1/CENPS complex composed of at least APITD1/CENPS and STRA13/CENPX. Belongs to the multisubunit FA complex composed of APITD1/CENPS, FANCA, FANCB, FANCC, FANCE, FANCF, FANCG, FANCL/PHF9, FANCM, FAAP24 and STRA13/CENPX. Interacts with APITD1/CENPS, FANCM and FAAP24. Binds DNA.||SUBCELLULAR LOCATION:Nucleus. Chromosome, centromere (Probable). Note=Localizes to chromatin.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=A8MT69-1; Sequence=Displayed; Name=2; Synonyms=Variant A; IsoId=A8MT69-2; Sequence=VSP 033948; Name=3; Synonyms=Variant B; IsoId=A8MT69-3; Sequence=VSP 033948, VSP 033949 |
Subcellular localization |
Nucleus.Chromosome, centromere(Probable). |
Gene name |
|
Protein sequence
|
MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVE LLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLL DF |
Database cross reference |
RefSeq Protein accession:NP_659435
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0000775;C:chromosome, centromeric region;IEA:UniProtKB-SubCell. GO:0043240;C:Fanconi anaemia nuclear complex;IDA:UniProtKB. |
GO-F |
GO:0003677;F:DNA binding;IDA:UniProtKB. GO:0005515;F:protein binding;IPI:UniProtKB. |
GO-P |
GO:0006281;P:DNA repair;IEA:UniProtKB-KW. |