Protein basic information
LiverAtlas Protein ID |
HuLPr15314 |
Uniprot ID |
|
Uniprot Acc |
P0CG37;B2RCY0;B9EJD3;Q53T05;Q9GZR3; |
Protein name |
Cryptic protein |
Comment |
FUNCTION:NODAL coreceptor involved in the correct establishment of the left-right axis. May play a role in mesoderm and/or neural patterning during gastrulation.||SUBCELLULAR LOCATION:Cell membrane; Lipid-anchor, GPI-anchor. Secreted. Note=Does not exhibit a typical GPI-signal sequence. The C-ter hydrophilic extension of the GPI-signal sequence reduces the efficiency of processing and could lead to the production of an secreted unprocessed form. This extension is found only in primates.||PTM:N-glycosylated (By similarity).||DISEASE:Defects in CFC1 are the cause of visceral heterotaxy autosomal type 2 (HTX2) [MIM:605376]. A form of visceral heterotaxy, a complex disorder due to disruption of the normal left-right asymmetry of the thoracoabdominal organs. It results in an abnormal arrangement of visceral organs, and a wide variety of congenital defects including cardiac malformations and situs inversus or situs ambiguus.||DISEASE:Defects in CFC1 are a cause of transposition of the great |
Subcellular localization |
Cell membrane;Lipid-anchor, GPI-anchor.Secreted. |
Gene name |
|
Protein sequence
|
MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTK VATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRA FGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQ RRSECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRC DPKDFLASHAHGPSAGGAPSLLLLLPCALLHRLLRPDAP AHPRSLVPSVLQRERRPCGRPGLGHRL |
Database cross reference |
RefSeq Protein accession:NP_115934
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
French Liver; |
Ontology annotation
GO-C |
GO:0031225;C:anchored to membrane;IEA:UniProtKB-KW. GO:0005576;C:extracellular region;IEA:UniProtKB-SubCell. GO:0005886;C:plasma membrane;IEA:UniProtKB-SubCell. |
GO-P |
GO:0007368;P:determination of left/right symmetry;NAS:UniProtKB. GO:0007369;P:gastrulation;IEA:UniProtKB-KW. |