Protein basic information
LiverAtlas Protein ID |
HuLPr15402 |
Uniprot ID |
|
Uniprot Acc |
Q9BUK0;A8K223;Q7Z588; |
Protein name |
Coiled-coil-helix-coiled-coil-helix domain-containing protein 7 |
Comment |
ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9BUK0-1; Sequence=Displayed; Name=2; IsoId=Q9BUK0-2; Sequence=VSP 038076; Name=3; IsoId=Q9BUK0-3; Sequence=VSP 038076, VSP 038077;||DISEASE:Note=A chromosomal aberration involving CHCHD7 is found in salivary gland pleiomorphic adenomas, the most common benign epithelial tumors of the salivary gland. Translocation t(6;8)(p21.3-22;q13) with PLAG1.||SIMILARITY:Belongs to the CHCHD7 family.||SIMILARITY:Contains 1 CHCH domain.||SEQUENCE CAUTION:Sequence=BAF82777.1; Type=Erroneous initiation; Sequence=EAW86776.1; Type=Erroneous gene model prediction; |
Gene name |
|
Protein sequence
|
MPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTY FLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRA VGNMPY |
Database cross reference |
RefSeq Protein accession:NP_001011667
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |