Protein basic information
LiverAtlas Protein ID |
HuLPr15629 |
Uniprot ID |
|
Uniprot Acc |
Q7Z7J9; |
Protein name |
Calcium/calmodulin-dependent protein kinase II inhibitor 1 |
Comment |
FUNCTION:Potent and specific inhibitor of CaM-kinase II (CAMK2) (By similarity).||SUBUNIT:Interacts with CAMK2B; the presence of Ca(2+)/calmodulin increases the interaction but is not essential (By similarity).||SUBCELLULAR LOCATION:Cell junction, synapse, synaptosome. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density (By similarity).||SIMILARITY:Belongs to the CAMK2N family. |
Subcellular localization |
Cell junction, synapse, synaptosome.Cell junction, synapse, postsynaptic cell membrane, postsynaptic density(By similarity). |
Gene name |
|
Protein sequence
|
MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQ NKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV |
Database cross reference |
RefSeq Protein accession:NP_061054
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0030054;C:cell junction;IEA:UniProtKB-KW. GO:0014069;C:postsynaptic density;IEA:UniProtKB-SubCell. GO:0045211;C:postsynaptic membrane;IEA:UniProtKB-KW. GO:0019717;C:synaptosome;IEA:UniProtKB-SubCell. |
Pathway
Pathway name |