Protein basic information
| LiverAtlas Protein ID |
HuLPr15707 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q9BXN2;B2R861;B7Z494;B7Z5A9;B7Z5B9;Q6IPS7;Q96DR9;Q96LD3;Q96PA5;Q96PA6;Q96PA7;Q96PA8;Q9H1K3; |
|
Protein name |
C-type lectin domain family 7 member A |
|
Comment |
FUNCTION:Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation (By similarity).||SUBUNIT:Isoform 5 interacts with RANBP9.||SUBCELLULAR LOCATION:Membrane; Single-pass type II membrane protein.||SUBCELLULAR LOCATION:Isoform 5:Cytoplasm.||SUBCELLULAR LOCATION:Isoform 6:Cytoplasm (Probable).||SUBCELLULAR LOCATION:Isoform 7:Cytoplasm (Probable).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=8; Name=1; Synonyms=A; IsoId=Q9BXN2-1; Sequence=Displayed; Name=2; |
|
Subcellular localization |
Membrane;Single-pass type II membrane protein. |
|
Gene name |
|
|
Protein sequence
|
MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAAS PPWRLIAVILGILCLVILVIAVVLGTMAIWRSNSGSNTL ENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSS PCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLK IDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWED GSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSV PSYSICEKKFSM |
|
Database cross reference |
RefSeq Protein accession:NP_072092
|
Liver relevance
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
French Liver;Human Fetal Liver;Human Liver Organelles;Chinese Liver; |
Ontology annotation
| GO-C |
GO:0005737;C:cytoplasm;IEA:UniProtKB-SubCell. GO:0016021;C:integral to membrane;TAS:UniProtKB. |
|
GO-F |
GO:0042287;F:MHC protein binding;NAS:UniProtKB. GO:0005529;F:sugar binding;IDA:UniProtKB. |
|
GO-P |
GO:0009756;P:carbohydrate mediated signaling;TAS:UniProtKB. GO:0042832;P:defense response to protozoan;NAS:UniProtKB. GO:0006954;P:inflammatory response;IEA:UniProtKB-KW. GO:0045087;P:innate immune response;IEA:UniProtKB-KW. GO:0006910;P:phagocytosis, |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr15707 |
PHOSPHORYLATION |
132 |
Y |
PhosphoSitePlus |
LTP |
N |
 
|
|
|
HuLPr15707 |
PHOSPHORYLATION |
160 |
S |
PhosphoSitePlus |
HTP |
N |
|
