Protein basic information
LiverAtlas Protein ID |
HuLPr15716 |
Uniprot ID |
|
Uniprot Acc |
Q8IZS7; |
Protein name |
C-type lectin-like domain family 1 |
Comment |
FUNCTION:May function in mediating immune cell-cell interactions. May act as a T-cell costimulatory molecule, enhancing anti-CD3- induced proliferation. May play a role in the interaction of dendritic cells with T-cells and the cells of the adaptive immune response.||SUBCELLULAR LOCATION:Cell membrane; Single-pass type II membrane protein.||TISSUE SPECIFICITY:Expressed in spleen, lymph node, and tonsil. Lower expression in peripheral blood, bone marrow, and colon. No expression detected in thymus. Highly expressed in dendritic and B-cells.||SIMILARITY:Contains 1 C-type lectin domain. |
Subcellular localization |
Cell membrane;Single-pass type II membrane protein. |
Gene name |
|
Protein sequence
|
MVSNFFHVIQVFEKSATLISKTEHIGFVIYSWRKSTTHLG SRRKFAISIYLSEVSLQKYDCPFSGTSFVVFSLFLICAM AGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCP AKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQ DITAMVRFNI |
Database cross reference |
RefSeq Protein accession:NP_742001
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005886;C:plasma membrane;IEA:UniProtKB-SubCell. |
GO-F |
GO:0005529;F:sugar binding;IEA:UniProtKB-KW. |