Protein basic information
LiverAtlas Protein ID |
HuLPr15763 |
Uniprot ID |
|
Uniprot Acc |
A8K4G0;Q1EG73;Q8IX40;Q8N6D1; |
Protein name |
CMRF35-like molecule 7 |
Comment |
FUNCTION:Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitement of GRB2.||SUBUNIT:Interacts with TYROBP, which enhances cell surface expression and activation properties. Interacts with GRB2 in the presence of FYN.||SUBCELLULAR LOCATION:Cell membrane; Single-pass type I membrane protein (By similarity).||TISSUE SPECIFICITY:Expressed exclusively in myeloid lineages.||PTM:Phosphorylation on Tyr-188 by FYN is required for interaction with GRB2.||SIMILARITY:Belongs to the CD300 family.||SIMILARITY:Contains 1 Ig-like V-type (immunoglobulin-like) domain.||SEQUENCE CAUTION:Sequence=AAH28091.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; Sequence=BAF83614.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; Sequence=EAW89170.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; |
Subcellular localization |
Cell membrane;Single-pass type I membrane protein(By similarity). |
Gene name |
|
Protein sequence
|
MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQ GWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIK DNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVK VIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFV KVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLT KDMAT |
Database cross reference |
RefSeq Protein accession:NP_777552
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005886;C:plasma membrane;IEA:UniProtKB-SubCell. |
GO-F |
GO:0004872;F:receptor activity;IEA:UniProtKB-KW. |