Protein basic information
LiverAtlas Protein ID |
HuLPr15866 |
Uniprot ID |
|
Uniprot Acc |
O95406;Q3SYM7; |
Protein name |
Protein cornichon homolog |
Comment |
FUNCTION:Involved in the selective transport and maturation of TGF-alpha family proteins.||SUBUNIT:Interacts with AREG immature precursor and with immature TGFA, i.e. with a prosegment and lacking full N-glycosylation, but not with the fully N-glycosylated form. In the Golgi apparatus, may form a complex with GORASP55 and transmembrane TGFA.||SUBCELLULAR LOCATION:Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane. Note=Located primarily in the ER; may cycle between the ER and the Golgi apparatus.||TISSUE SPECIFICITY:Highly expressed in heart, liver, skeletal muscle, pancreas, adrenal medulla and cortex, thyroid, testis, spleen, appendix, peripheral blood lymphocytes and bone marrow. Lower expression found in brain, placenta, lung, kidney, ovary, small intestine, stomach, lymph node, thymus and fetal liver.||SIMILARITY:Belongs to the cornichon family. |
Subcellular localization |
Endoplasmic reticulum membrane;Multi-pass membrane protein.Golgi apparatus membrane. |
Gene name |
|
Protein sequence
|
MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKN PIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNM PLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKE GWCKLAFYLLAFFYYLYGMIYVLVSS |
Database cross reference |
RefSeq Protein accession:NP_005767
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005789;C:endoplasmic reticulum membrane;IEA:UniProtKB-SubCell. GO:0000139;C:Golgi membrane;IEA:UniProtKB-SubCell. GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. |
GO-P |
GO:0006955;P:immune response;TAS:ProtInc. GO:0035556;P:intracellular signal transduction;IEA:InterPro. GO:0016192;P:vesicle-mediated transport;IEA:UniProtKB-KW. |