Protein basic information
LiverAtlas Protein ID |
HuLPr16235 |
Uniprot ID |
|
Uniprot Acc |
Q7Z4B0;Q8NHR5; |
Protein name |
Putative uncharacterized protein encoded by NCRNA00305 |
Comment |
SUBCELLULAR LOCATION:Secreted (Potential).||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q7Z4B0-1; Sequence=Displayed; Note=No experimental confirmation available; Name=2; IsoId=Q7Z4B0-2; Sequence=VSP 014651; Note=No experimental confirmation available;||CAUTION:Product of a dubious CDS prediction. May be a non-coding RNA. |
Subcellular localization |
Secreted(Potential). |
Gene name |
|
Protein sequence
|
MINLHRLCIIHVVATLLSTLLSLISVAISATCKDEKGKQE METGQQPSGLSATLTKVKCAKRQKTVVRVRFYMLSMKNK ACRKNLSKGYNQRPEGSKEESHMVVKEKRKGDH |
Database cross reference |
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005576;C:extracellular region;IEA:UniProtKB-SubCell. |
Post-translational modification
LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
HuLPr16235 |
PHOSPHORYLATION |
65 |
T |
PhosphoSitePlus |
HTP |
N |
![]() ![]() ![]() ![]() ![]() |