Protein basic information
LiverAtlas Protein ID |
HuLPr16257 |
Uniprot ID |
|
Uniprot Acc |
O60519;B5BUM5; |
Protein name |
cAMP-responsive element-binding protein-like 2 |
Comment |
FUNCTION:May play a regulatory role in the cell cycle. Identification in a chromosomal region frequently deleted in various cancers suggests that it might act as a tumor suppressor.||SUBCELLULAR LOCATION:Nucleus (By similarity).||PTM:Phosphorylated by AMPK.||SIMILARITY:Belongs to the bZIP family. ATF subfamily.||SIMILARITY:Contains 1 bZIP domain. |
Subcellular localization |
Nucleus(By similarity). |
Gene name |
|
Protein sequence
|
MDDSKVVGGKVKKPGKRGRKPAKIDLKAKLERSRQSAREC RARKKLRYQYLEELVSSRERAICALREELEMYKQWCMAM DQGKIPSEIKALLTGEEQNKSQQNSSRHTKAGKTDANSN SW |
Database cross reference |
RefSeq Protein accession:NP_001301
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Chinese Liver;French Liver;Human Fetal Liver;Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0005634;C:nucleus;TAS:ProtInc. |
GO-F |
GO:0046983;F:protein dimerization activity;IEA:InterPro. GO:0043565;F:sequence-specific DNA binding;IEA:InterPro. GO:0003700;F:sequence-specific DNA binding transcription factor activity;TAS:ProtInc. |
GO-P |
GO:0007049;P:cell cycle;IEA:UniProtKB-KW. GO:0006355;P:regulation of transcription, DNA-dependent;IEA:UniProtKB-KW. GO:0007165;P:signal transduction;TAS:ProtInc. |
Pathway
Pathway name |