Protein basic information
| LiverAtlas Protein ID |
HuLPr16306 |
|
Uniprot ID |
|
|
Uniprot Acc |
P02741;A8K078;D3DVD9;D3DVE0;Q08AK3;Q8WW75; |
|
Protein name |
C-reactive protein |
|
Comment |
FUNCTION:Displays several functions associated with host defense:it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.||COFACTOR:Binds 2 calcium ions per subunit.||SUBUNIT:Homopentamer. Pentaxin (or pentraxin) have a discoid arrangement of 5 non-covalently bound subunits.||INTERACTION:P12318:FCGR2A; NbExp=1; IntAct=EBI-1395983, EBI-1395970; P31995:FCGR2C; NbExp=2; IntAct=EBI-1395983, EBI-1396036;||SUBCELLULAR LOCATION:Secreted.||ALTERNATIVE PRODUCTS:Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P02741-1; Sequence=Displayed; Name=2; IsoId=P02741-2; Sequence=VSP 004656; Note=No experimental confirmation available;||TISSUE SPECIFICITY:Found in plasma.||INDUCTION:The concentration of CRP in plasma increases greatly during acute phase response to tissue injury, infe |
|
Subcellular localization |
Secreted. |
|
Gene name |
|
|
Related liver disease name |
|
|
Protein sequence
|
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSL KAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDN EILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSW ESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQ DSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGG PFSPNVLNWRALKYEVQGEVFTKPQLWP |
|
Database cross reference |
RefSeq Protein accession:NP_000558
|
Liver relevance
| Liver sepcificity |
Yes/No |
Yes |
|
Evidence |
BodyMap |
|
|
Quality score |
|
|
|
HCC significant Proteins |
Yes/No |
Yes |
|
Quality score |
|
|
|
HLPP validation |
Yes/No |
Yes |
|
Project name |
Chinese Liver;French Liver;Human Liver Organelles; |
Ontology annotation
|
GO-F |
GO:0033265;F:choline binding;TAS:BHF-UCL. GO:0051637;F:Gram-positive bacterial cell surface binding;TAS:BHF-UCL. GO:0030169;F:low-density lipoprotein particle binding;IDA:BHF-UCL. GO:0046872;F:metal ion binding;IEA:UniProtKB-KW. GO:0005515;F:protein bi |
|
GO-P |
GO:0006953;P:acute-phase response;TAS:BHF-UCL. GO:0010888;P:negative regulation of lipid storage;IDA:BHF-UCL. GO:0010745;P:negative regulation of macrophage derived foam cell differentiation;IDA:BHF-UCL. GO:0008228;P: |