Protein basic information
LiverAtlas Protein ID |
HuLPr16553 |
Uniprot ID |
|
Uniprot Acc |
Q9H4I9;B2R5D1;Q8TAB9; |
Protein name |
UPF0466 protein C22orf32, mitochondrial |
Comment |
SUBCELLULAR LOCATION:Mitochondrion (Potential). Membrane; Single- pass membrane protein (Potential).||SIMILARITY:Belongs to the UPF0466 family. |
Subcellular localization |
Mitochondrion(Potential).Membrane;Single- pass membrane protein(Potential). |
Gene name |
|
Protein sequence
|
MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGR SLVPSRSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLY VGTLISKNFAALLEEHDIFVPEDDDDDD |
Database cross reference |
RefSeq Protein accession:NP_201575
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles; |
Ontology annotation
GO-C |
GO:0016021;C:integral to membrane;IEA:UniProtKB-KW. GO:0005739;C:mitochondrion;IEA:UniProtKB-SubCell. |