Protein basic information
LiverAtlas Protein ID |
HuLPr16628 |
Uniprot ID |
|
Uniprot Acc |
O95715;B3KQU8;Q6UW97;Q86U69;Q9BTR1;Q9NS21; |
Protein name |
C-X-C motif chemokine 14 |
Comment |
FUNCTION:Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactive for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.||SUBCELLULAR LOCATION:Secreted.||TISSUE SPECIFICITY:Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte- derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.||INDUCTION:Up-regulated in peripheral blood lymphocytes in response to bacterial lipopolysaccharides (LPS).||SIMILARITY:Belongs to the intercrine alpha (chemokine CxC) family.||CAUTION:It is uncertain whether Met-1 or Met-13 is the initiator.||SEQUENCE CAUTION:Sequence=AAD38944.1; Type=Erroneous initiation;||WEB RESOURCE:Name=Wikipedia; Note=CXCL14 entry; URL="http://en.wi |
Subcellular localization |
Secreted. |
Gene name |
|
Protein sequence
|
MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCS RKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYR GQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Database cross reference |
RefSeq Protein accession:NP_004878
|
Liver relevance
HLPP validation |
Yes/No |
Yes |
Project name |
Human Liver Organelles;Chinese Liver; |
Ontology annotation
GO-C |
GO:0005615;C:extracellular space;IEA:UniProtKB-KW. GO:0005794;C:Golgi apparatus;IDA:LIFEdb. |
GO-F |
GO:0008009;F:chemokine activity;TAS:ProtInc. |
GO-P |
GO:0007267;P:cell-cell signaling;TAS:ProtInc. GO:0006935;P:chemotaxis;TAS:ProtInc. GO:0006955;P:immune response;IEA:InterPro. GO:0007165;P:signal transduction;TAS:ProtInc. |
Pathway
Pathway name |